BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1420 (735 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces p... 27 2.8 SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces p... 27 3.7 SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 27 3.7 SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|... 26 4.8 SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch... 26 6.4 SPBC1539.07c |||glutathione-dependent formaldehyde dehydrogenase... 26 6.4 SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S... 25 8.5 >SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces pombe|chr 1|||Manual Length = 506 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 483 DKCGKEFNEWLVSVDTRSSM-QYVSMQYLK 569 D C EFNEW V+ + +Y S++Y++ Sbjct: 470 DICPDEFNEWKDPVEAEKDIFRYFSLEYIE 499 >SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 505 Score = 26.6 bits (56), Expect = 3.7 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -2 Query: 116 MIGVTGVDSLGNTKIEISV 60 MIG++GV LGNT + +S+ Sbjct: 280 MIGLSGVHQLGNTSLAVSL 298 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 26.6 bits (56), Expect = 3.7 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 8/70 (11%) Frame = +1 Query: 25 IIKYNIEANIILTDISILVLPRLST-PVTPI-------INNILFGDKIDLESQSNGSDHK 180 I++ IEA I + ++LV+P T VT I I++ + GD++ L + + SD + Sbjct: 483 ILEGKIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEISSSICGDQVRLRVRGDDSDVQ 542 Query: 181 TGQCIEKYEN 210 TG + +N Sbjct: 543 TGYVLTSTKN 552 >SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|chr 1|||Manual Length = 512 Score = 26.2 bits (55), Expect = 4.8 Identities = 12/41 (29%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +1 Query: 10 TTPVNIIKYNIEANIILT---DISILVLPRLSTPVTPIINN 123 T VN++++N E NI+ T + +I++ +TP+T + ++ Sbjct: 67 TQAVNVVRFNPEGNILATAGDEGTIMLWVPTNTPITTLADD 107 >SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 677 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 420 SSASVS*ALSYP*ISSYIPYRNNFL 346 SS S+S +L+YP I +P +N FL Sbjct: 495 SSNSLSTSLTYPLIEIILPIKNGFL 519 >SPBC1539.07c |||glutathione-dependent formaldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 25.8 bits (54), Expect = 6.4 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 667 SNFQCRKSTLCFLRGC-SFKCYVYLQKITLN*RDFKYCIETYCML 536 S F CR TL GC SF Y + I+L + + C+L Sbjct: 130 SRFSCRDKTLLHYMGCSSFSQYTVVADISLVAISHSAPLRSICLL 174 >SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |Schizosaccharomyces pombe|chr 2|||Manual Length = 1944 Score = 25.4 bits (53), Expect = 8.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 674 YIFEFSMSKEYIVFFKGMFIQMLRLLTKNHIK 579 ++F F EY+V+FK + L+L K +K Sbjct: 61 FLFSFQNDNEYLVWFKKHLNERLQLCPKCIVK 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,762,838 Number of Sequences: 5004 Number of extensions: 55097 Number of successful extensions: 149 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -