BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1418 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.8 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 9.0 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.0 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 9.0 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 317 TSTLRSSTMLSQELEPTNKPSSRSCARFPTMVSVP 421 ++T+ +S+ + PT +S SC P+M P Sbjct: 10 STTMATSSNAMSPMTPTYSMNSMSCVSMPSMNCSP 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 427 AFYEQLYGKSLESDLKGDTSGH 492 A+Y Q GK L SD+ D H Sbjct: 1833 AWYRQGVGKYLPSDIDPDLCTH 1854 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +1 Query: 562 LKPMLKHWPPLVKVKWGTDESIFNSILIT 648 LK KHW + + KW E L T Sbjct: 188 LKGNAKHWTGIFQKKWRGYEDFRRDFLRT 216 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = -3 Query: 395 VHRISMMAYSSVPIPETASWSSLA*KWGR 309 + ++++ Y+SV E W++ WG+ Sbjct: 172 IPQLTIFTYTSVGEDEYDCWATFQEPWGK 200 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 623 DSSVPHLTFTSGGQCFSIG 567 DS H T +GG C +G Sbjct: 145 DSHCDHTTCKNGGTCQDLG 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,795 Number of Sequences: 336 Number of extensions: 2964 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -