BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1409 (569 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 42 0.010 UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein;... 32 8.2 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 41.9 bits (94), Expect = 0.010 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 62 GKCFR*CSSCDDPRISPLTXQYECPQ 139 GKCFR C S ++ RISPLT +Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 389 Score = 32.3 bits (70), Expect = 8.2 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 73 SLMFVLRRSKNFTSNVAIRMPPVIPINHYLG 165 S+M V+ RS FT IR+PP+ I+H+LG Sbjct: 20 SVMGVVERSAVFTRQRDIRLPPIPGISHHLG 50 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,165,409 Number of Sequences: 1657284 Number of extensions: 8772015 Number of successful extensions: 18264 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18260 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38738010471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -