BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1408 (468 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 25 1.3 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 3.0 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 5.3 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 5.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 22 9.3 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 22 9.3 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 25.0 bits (52), Expect = 1.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 137 VFXFTSESVGEGHPDKMCDQISDAFLDAHLNQD 235 VF G G PD QI A L+ +N D Sbjct: 2 VFGSKVIKAGNGEPDAFETQIGQAILELEMNSD 34 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 3.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 166 RGSSRQNVRPNKRRFSRRAPESGSGRK 246 RGS R R R SR SGSG + Sbjct: 1158 RGSRRSRSRSRSRSGSRSRSRSGSGSR 1184 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 5.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 155 ESVGEGHPDKMCDQISDAFLDAHLNQDPDA 244 E +GEG PD +C L HL +D D+ Sbjct: 1030 ELLGEGGPDPVCPDT----LQRHLLRDADS 1055 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.0 bits (47), Expect = 5.3 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +2 Query: 365 MXPSKGLDYKTCSVMLALXQQSPNIAAGVHDNR 463 + P+K C + +AL + VHD+R Sbjct: 53 LVPAKDFPSAVCEMCIALLHDFDTLYQNVHDHR 85 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.2 bits (45), Expect = 9.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 6 GGSFRGTXWGYXSGL 50 GG+ G WG+ +GL Sbjct: 450 GGTIIGVIWGFLTGL 464 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 22.2 bits (45), Expect = 9.3 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 250 RIETITKTGMVLLCGEITXKAXVDYQKVVRETVKHIG 360 RI G++ G+ VDY KVV+ ++ + G Sbjct: 291 RIRGTKNGGLLFELGKSDDDCGVDYAKVVQNSIGNNG 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,624 Number of Sequences: 2352 Number of extensions: 10373 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -