BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1406 (673 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 23 3.0 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 5.3 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.6 bits (46), Expect = 3.0 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +1 Query: 529 EKCHRASGFHPKRTPSSR 582 E C++ GF+P+ P + Sbjct: 244 EMCYKLQGFYPEEAPQRK 261 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +1 Query: 58 RALKELAVTVKEATEDLVGYTAAEEAKRLRAVNVKQEQE 174 R E+ ++ EDLVG+ + + N KQ E Sbjct: 213 RKTTEIPPEPEDYVEDLVGHIEVNHSAPITTCNKKQHLE 251 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,046 Number of Sequences: 336 Number of extensions: 2734 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -