BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1401 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.6 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.6 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 8.6 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 8.6 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 472 EQSVTGSGKLHYASRTDWHTIPQWTPCAPT 561 E+++ G G++ + ++PQ P PT Sbjct: 167 EEALQGDGRMRQHVMHNLSSVPQPQPVLPT 196 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 446 ASLGLIMN*SNR*LVRESYTMRAEQIGIR 532 ++LG+ +N L+R+ + AEQ+G R Sbjct: 329 SNLGIFPKTTNEQLLRKELLLFAEQMGQR 357 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 26 KLRAHRTIKIGIYLVESEFKV 88 K++ RT+KIG+Y F + Sbjct: 560 KMQPLRTLKIGVYRNIKNFNI 580 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 472 EQSVTGSGKLHYASRTDWHTIPQWTPCAPT 561 E+++ G G++ + ++PQ P PT Sbjct: 167 EEALQGDGRMRQHVMHNLSSVPQPQPVLPT 196 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 Query: 472 EQSVTGSGKLHYASRTDWHTIPQWTPCAPT 561 E+++ G G++ + ++PQ P PT Sbjct: 167 EEALQGDGRMRQHVMHNLSSVPQPQPVLPT 196 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,748 Number of Sequences: 336 Number of extensions: 2366 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -