BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1401 (633 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB242827-1|BAE72693.1| 365|Homo sapiens Pex26pL153V/fs/Ter prot... 33 1.1 BC046200-1|AAH46200.1| 251|Homo sapiens chromosome 17 open read... 31 4.5 >AB242827-1|BAE72693.1| 365|Homo sapiens Pex26pL153V/fs/Ter protein. Length = 365 Score = 32.7 bits (71), Expect = 1.1 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 421 LNYEQALASVARLNYELEQSVTGSGKLHYASRTDWHTIPQWTPCAPTLLTS 573 + ++ A S Y+L Q GSG+LH+ + T ++ + PCAP L S Sbjct: 267 VRFDPASPSSLHFLYKLAQLFAGSGRLHFLASTSSASVTE-GPCAPQPLCS 316 >BC046200-1|AAH46200.1| 251|Homo sapiens chromosome 17 open reading frame 82 protein. Length = 251 Score = 30.7 bits (66), Expect = 4.5 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = -2 Query: 338 VDMGRSRGAAHGGTAASRGVSTSSIADRHRPPR 240 +D G R A HGGTA G + S RHRPPR Sbjct: 212 IDCG-PRQAGHGGTATDTGRAGSGA--RHRPPR 241 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,953,669 Number of Sequences: 237096 Number of extensions: 1463968 Number of successful extensions: 3340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3340 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -