BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1400 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 6.0 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 22 6.0 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 22 6.0 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 22 6.0 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 22 6.0 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -1 Query: 615 PEGVDMTKAVAGSNITPGATCTGSKATCS--SISRSRGTWSRL 493 P+GVD+ + + + T A CT + T + SI R + + ++ Sbjct: 55 PQGVDLKRVLPEALQTNCAKCTEKQRTAAYRSIKRLKKEYPKI 97 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 518 LEIEEQVALEPVQVAPGVIFDPATALVISTPSGVSENIIEAAY 646 LE+ +++++E + +A + DP A ++ V E E A+ Sbjct: 250 LEVLQKMSVEEMYLAAEKVHDPFIASLVRPHGPVIEKKPEGAF 292 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 518 LEIEEQVALEPVQVAPGVIFDPATALVISTPSGVSENIIEAAY 646 LE+ +++++E + +A + DP A ++ V E E A+ Sbjct: 250 LEVLQKMSVEEMYLAAEKVHDPFIASLVRPHGPVIEKKPEGAF 292 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 518 LEIEEQVALEPVQVAPGVIFDPATALVISTPSGVSENIIEAAY 646 LE+ +++++E + +A + DP A ++ V E E A+ Sbjct: 250 LEVLQKMSVEEMYLAAEKVHDPFIASLVRPHGPVIEKKPEGAF 292 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 518 LEIEEQVALEPVQVAPGVIFDPATALVISTPSGVSENIIEAAY 646 LE+ +++++E + +A + DP A ++ V E E A+ Sbjct: 249 LEVLQKMSVEEMYLAAEKVHDPFIASLVRPHGPVIEKKPEGAF 291 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,655 Number of Sequences: 336 Number of extensions: 3257 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -