BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1400 (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 26 1.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 4.3 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 491 IRRDHVPRDLE-IEEQVALEPVQVAPGVIFDPATALVISTP 610 +R PR+++ I + + P ++ P V+F ALV TP Sbjct: 594 LRNIEEPRNVKLIYDVLKFSPPEIEPAVLFATNNALVCETP 634 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 462 MPDKMEISEISDVTTY 509 MP + E+ E+SDVT Y Sbjct: 1124 MPQQKEVVELSDVTQY 1139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,925 Number of Sequences: 2352 Number of extensions: 13837 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -