BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1396 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81136-1|CAB03458.1| 1256|Caenorhabditis elegans Hypothetical pr... 29 3.7 Z82060-3|CAB04883.1| 206|Caenorhabditis elegans Hypothetical pr... 27 8.6 U64598-8|AAQ82848.1| 396|Caenorhabditis elegans Hypothetical pr... 27 8.6 >Z81136-1|CAB03458.1| 1256|Caenorhabditis elegans Hypothetical protein W02B8.2 protein. Length = 1256 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -3 Query: 443 VHDEQTLEINKNILNNRKVFKSIK*LSD 360 V D+++LE++++ N +KV K +K LSD Sbjct: 212 VKDQRSLEVHQDQENTQKVLKEVKQLSD 239 >Z82060-3|CAB04883.1| 206|Caenorhabditis elegans Hypothetical protein T27F6.4 protein. Length = 206 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +2 Query: 443 RDRN-RTVVILKKYE--TVSRYLISVNGKGRYHHHH 541 +DR+ + VV KY T + +L SV+ +HHHH Sbjct: 85 KDRSEKNVVTNLKYRKPTANHHLDSVHSSSEHHHHH 120 >U64598-8|AAQ82848.1| 396|Caenorhabditis elegans Hypothetical protein C52B9.2b protein. Length = 396 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 Query: 463 YCSVSVTYMTNKHLRLTKIFLIIVRYLKALNNSPTVLLPFPVIQKHFLT 317 Y +S TN H+R F I + A+ + PT L P P++ +T Sbjct: 26 YPDISPPTPTNSHIRCWAQFSIAQQLPCAVPSFPTSLFPLPIMNDEPMT 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,767,722 Number of Sequences: 27780 Number of extensions: 270528 Number of successful extensions: 566 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -