BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1396 (640 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 26 0.35 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.1 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 24 1.1 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 22 4.4 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 5.8 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 25.8 bits (54), Expect = 0.35 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 436 TNKHLRLTKIFLIIVRYLKALNN 368 TN HL++TKIF I ++ K +N+ Sbjct: 110 TNVHLKITKIFQCITKF-KTIND 131 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 421 SSVCSSCT*QKQNSSNLKKIRNRKSLSDLCKRQ 519 S+ CS+ Q+ + S++ + NR S C R+ Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSESSGYCGRR 50 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 421 SSVCSSCT*QKQNSSNLKKIRNRKSLSDLCKRQ 519 S+ CS+ Q+ + S++ + NR S C R+ Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSESSGYCGRR 50 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 440 HDEQTLEINKNILNNRKVFKSIK*LSDCIAAIPSDSK 330 +DE L+ + N + + +K LS+CI A S K Sbjct: 91 NDEIQLDKLVEMANRKNISIDVKMLSECINANKSTDK 127 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/42 (26%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 466 YYCSVSVTY-MTNKHLRLTKIFLIIVRYLKALNNSPTVLLPF 344 ++C +S + + RL K+ + IV + +SPT+L+ + Sbjct: 57 FFCDMSPSLSLLCADTRLNKLAVFIVAGAVGVFSSPTILISY 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,778 Number of Sequences: 438 Number of extensions: 3381 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -