BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1395 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1765 - 29329350-29331290,29331705-29331827,29332205-29333026 29 3.3 05_02_0037 + 5883285-5884292 28 7.7 >07_03_1765 - 29329350-29331290,29331705-29331827,29332205-29333026 Length = 961 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 126 AGPSNPXGFCSTCSGWT*LSLICCKGTNCGCSCS 25 A PS P C T S + S+I C+ CGC S Sbjct: 714 APPSKPPSCCVTFSAFYNESVIPCRTCACGCPAS 747 >05_02_0037 + 5883285-5884292 Length = 335 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 132 KCAGPSNPXGFCSTCSGWT*LSLICCKGTNCGC 34 +C PS P + C + CC G NC C Sbjct: 303 RCCWPSPPSVWWPRCGCGGGCGVFCCGGENCRC 335 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,475,467 Number of Sequences: 37544 Number of extensions: 285268 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -