BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1391 (584 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Sc... 27 1.5 SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosa... 27 2.0 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 26 3.5 SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar... 25 6.2 >SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1958 Score = 27.5 bits (58), Expect = 1.5 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = +3 Query: 303 QKLRKENEICALKGWRDECFEVSTAFYQESLLEMDRSAICLFGIRNYGVSV 455 QKL + N +++ RD E S A E L ++ S+IC G RNY SV Sbjct: 303 QKLAQINLAVSIRSMRDIFREESCAVLLEWLADIAGSSIC--GKRNYFSSV 351 >SPAC20H4.04 |mfh2||ATP-dependent 3' to 5' DNA helicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 27.1 bits (57), Expect = 2.0 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +1 Query: 388 RAYWRWTGVPYAYLVLEIMASVSPGYLNHPSKRTMHLVTAAEFYQTNMGW 537 +++W +T P+A+ + + + LNHP + + F T+ G+ Sbjct: 420 QSFWLFTSKPFAFYLEHLHNKIQGLSLNHPKMNHLLELLKEHFKDTSEGY 469 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 26.2 bits (55), Expect = 3.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 156 WASSWSCPT*CFKIFAAFPRGV 221 W S WS P C +++ FP G+ Sbjct: 30 WVSLWSVPESCPEVYDFFPPGL 51 >SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.4 bits (53), Expect = 6.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 488 LCIWLQQRSFTKQTW 532 L IW+ +RS TKQTW Sbjct: 151 LRIWVPRRSPTKQTW 165 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,556,384 Number of Sequences: 5004 Number of extensions: 53751 Number of successful extensions: 145 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -