BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1391 (584 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81498-2|CAB04085.1| 760|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z54284-1|CAA91059.1| 2198|Caenorhabditis elegans Hypothetical pr... 30 1.4 >Z81498-2|CAB04085.1| 760|Caenorhabditis elegans Hypothetical protein F11A6.1b protein. Length = 760 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = +1 Query: 136 CKPFIVAGHQVGLVRPDVLKYLQRFPEVFRIAGKYVELNPLLEITKKGP 282 C+ F + ++ P+V + LQ+FP++ R K++E++ + I +K P Sbjct: 518 CRQFYPSRYKRFSNLPEVYRSLQKFPKISRFFQKFLEVSEVHTIFQKFP 566 >Z54284-1|CAA91059.1| 2198|Caenorhabditis elegans Hypothetical protein D2085.1 protein. Length = 2198 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 3/98 (3%) Frame = +3 Query: 207 FPRGVQNRREICGIKSAFRDYKERTTRVADVLQKLRKENEIC---ALKGWRDECFEVSTA 377 +P V+ + G+ S F D +E +A Q L N++ +LKGW++ +EV Sbjct: 547 YPVLVRAAYALGGLGSGFADNREELIAIAQ--QALAHSNQVLVDKSLKGWKEVEYEVVRD 604 Query: 378 FYQESLLEMDRSAICLFGIRNYGVSVTRLSQSSQ*KDY 491 Y + + + GI V SQ+ ++Y Sbjct: 605 AYDNCITVCNMENVDPLGIHTGESVVVAPSQTLSDREY 642 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,061,223 Number of Sequences: 27780 Number of extensions: 298195 Number of successful extensions: 703 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1226509528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -