BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1388 (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 42 5e-04 SB_45935| Best HMM Match : Aldolase_II (HMM E-Value=1.1e-27) 37 0.015 SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) 34 0.082 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 31 1.0 SB_31615| Best HMM Match : GCC2_GCC3 (HMM E-Value=0.053) 31 1.0 SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12094| Best HMM Match : Myb_DNA-binding (HMM E-Value=0.00041) 30 1.8 SB_43972| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06) 29 2.3 SB_31603| Best HMM Match : DUF1279 (HMM E-Value=0.51) 29 3.1 SB_24425| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 3.5 SB_8961| Best HMM Match : NUDE_C (HMM E-Value=5.6) 24 3.9 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 4.1 SB_40461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_52455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_45968| Best HMM Match : DUF1279 (HMM E-Value=1.2) 28 5.4 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 28 5.4 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_40412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_43438| Best HMM Match : DUF965 (HMM E-Value=0.71) 28 7.1 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) 28 7.1 SB_34319| Best HMM Match : C2 (HMM E-Value=0.003) 28 7.1 SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) 28 7.1 SB_58782| Best HMM Match : Hormone_5 (HMM E-Value=2.1) 27 9.4 SB_51216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_52016| Best HMM Match : Cystatin (HMM E-Value=0.87) 27 9.4 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 27 9.4 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = +3 Query: 366 TEEEDERLKQRPADIDADVREMERRKRVEALMSSKLFREELERVLDQQCTRAATLPLLAE 545 TE+ +R P I+ DVR ++ R+RV ++ ++FREELE ++ +L Sbjct: 222 TEKGFDRAISTPDQINRDVRGLKLRQRVSIVLGDEVFREELEEIVGSNSCSPGDPLVLER 281 Query: 546 DQRRWSA 566 RWS+ Sbjct: 282 PPPRWSS 288 >SB_45935| Best HMM Match : Aldolase_II (HMM E-Value=1.1e-27) Length = 468 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/37 (40%), Positives = 27/37 (72%) Frame = +3 Query: 393 QRPADIDADVREMERRKRVEALMSSKLFREELERVLD 503 +RP D+ DVR ++ R+RV +++ K+ REELE +++ Sbjct: 28 RRPDDVLRDVRGLKLRQRVSLVLNDKVLREELEDIVE 64 >SB_40000| Best HMM Match : Pox_A32 (HMM E-Value=0.053) Length = 946 Score = 34.3 bits (75), Expect = 0.082 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -2 Query: 456 ELRRASGVPFRGHRRRCRPDAASSARLPPRWTGARCRSGSSLSPSQPFRQLESIDLSSKT 277 E R + + RG RR AA+ R + + A CRSG S S S+ FR + + Sbjct: 820 EPARCNTLDRRGRRRDSARKAAAGGRTADQGSAA-CRSGDSASRSRTFRHEGPTHICTSV 878 Query: 276 W--VSNPVAQSFRSHAR 232 + V + V Q ++ H R Sbjct: 879 YRIVDDAVEQDYKDHHR 895 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 32.3 bits (70), Expect = 0.33 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = +3 Query: 363 STEEEDERLKQRPADIDADVREMERRKRVEALMSSKLFREELERVLDQQCTR 518 +T+EE ER K + D++ E ER+KR EA + REE ER +++ R Sbjct: 411 TTDEEKERKKSETKNKDSEDEEKERKKR-EAEEEEERRREEEERREEEERKR 461 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 30.7 bits (66), Expect = 1.0 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 322 RRTQR-RSRTAPGPCPPRRKTSA*SSVRPTSTPMSAK 429 RR +R R R +PGPC P KT A PTS + AK Sbjct: 163 RRGRRDRFRRSPGPCTPVVKTPAVPVRAPTSEEVQAK 199 >SB_31615| Best HMM Match : GCC2_GCC3 (HMM E-Value=0.053) Length = 870 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 309 VGMAETD-SETIPNGTGPLSTEEEDERLKQRPADIDADVREMERRKRV 449 +G+ E + E + T P+ E+EDE + + D DA + ++R+KRV Sbjct: 822 LGILEVELEEPVVEQTNPIDGEDEDEEILEEQQDEDA--KRVKRKKRV 867 >SB_29502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 30.7 bits (66), Expect = 1.0 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 322 RRTQR-RSRTAPGPCPPRRKTSA*SSVRPTSTPMSAK 429 RR +R R R +PGPC P KT A PTS + AK Sbjct: 163 RRGRRDRFRRSPGPCTPVVKTPAVPVRAPTSEEVQAK 199 Score = 30.7 bits (66), Expect = 1.0 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 322 RRTQR-RSRTAPGPCPPRRKTSA*SSVRPTSTPMSAK 429 RR +R R R +PGPC P KT A PTS + AK Sbjct: 434 RRGRRDRFRRSPGPCTPVVKTPAVPVRAPTSEEVQAK 470 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 328 TQRRSRTAPGPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLLCPRSCSARNWNGSSTS 507 T + AP PR ++ +S TSTP + SA PR+ S + STS Sbjct: 58 TSNSTTRAPSTSTPRAGSTTTTSAPSTSTPRTGSTTTTSAPSTSTPRTGSTTTTSAPSTS 117 >SB_12094| Best HMM Match : Myb_DNA-binding (HMM E-Value=0.00041) Length = 754 Score = 29.9 bits (64), Expect = 1.8 Identities = 24/70 (34%), Positives = 36/70 (51%) Frame = +1 Query: 208 RYAGPSAGPCMTPEGLCYRITNPGLA*QINRLELSEWLRRTQRRSRTAPGPCPPRRKTSA 387 R GP++G TP +PGL +NR ++ ++ R ++ R APG P+ + SA Sbjct: 654 RPLGPASGG--TPSA---DFISPGLLQHVNRHDVDTYIHRIKQGKRHAPG---PQSRQSA 705 Query: 388 *SSVRPTSTP 417 V TSTP Sbjct: 706 --KVVKTSTP 713 >SB_43972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 337 RSRTAPGPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLLC 462 R + P P PPRRK S S P +TP S C Sbjct: 800 RKHSDPPPLPPRRKKSHEDSPSPCTTPRRKSTELSRCSPHFC 841 >SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06) Length = 1691 Score = 29.5 bits (63), Expect = 2.3 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 2/88 (2%) Frame = +3 Query: 318 AETDSETIPNGTGPLSTEEEDERLKQRP--ADIDADVREMERRKRVEALMSSKLFREELE 491 A++D++ T L E L Q + +D++ EMER++ L+ S+ ELE Sbjct: 570 ADSDAQKFKKLTKELLALERAYALLQAQVGSTMDSEREEMERQQLQSDLIESQARIHELE 629 Query: 492 RVLDQQCTRAATLPLLAEDQRRWSAGEL 575 R+LD A AE +R + EL Sbjct: 630 RMLDNSSQLVA-----AESERNRAVSEL 652 >SB_31603| Best HMM Match : DUF1279 (HMM E-Value=0.51) Length = 161 Score = 29.1 bits (62), Expect = 3.1 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 312 GMAETDSETIPNGTGPLSTEEED-ERLKQRPADIDADVREMERRKRVEALMSSKLFREEL 488 G+ TD ETI P S +E ER ++R ++ID E+ER R L + K RE + Sbjct: 5 GVVATDRETIDGPNTPESRRQEARERNEERLSEID----ELERENR--ELENQKPLRERI 58 Query: 489 ERV 497 + + Sbjct: 59 KAI 61 >SB_24425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 23.8 bits (49), Expect(2) = 3.5 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 406 TSTPMSAKWNAGSASKLLCPRSCSARNWNGSSTSNAPG 519 TST A + G+ LL C+ NW S+ PG Sbjct: 483 TSTSNEASASPGT-DPLLANVGCTPPNWTSSNPGAVPG 519 Score = 23.4 bits (48), Expect(2) = 3.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 334 RRSRTAPGPCPPRRKTSA*SSVRPTSTPMSA 426 + S APG P S+ S PTS P S+ Sbjct: 412 QESDPAPGASSPTTSQSSVSEPTPTSKPKSS 442 >SB_8961| Best HMM Match : NUDE_C (HMM E-Value=5.6) Length = 298 Score = 23.8 bits (49), Expect(2) = 3.9 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 406 TSTPMSAKWNAGSASKLLCPRSCSARNWNGSSTSNAPG 519 TST A + G+ LL C+ NW S+ PG Sbjct: 147 TSTSNEASASPGT-DPLLANVGCTPPNWTSSNPGAVPG 183 Score = 23.4 bits (48), Expect(2) = 3.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 334 RRSRTAPGPCPPRRKTSA*SSVRPTSTPMSA 426 + S APG P S+ S PTS P S+ Sbjct: 76 QESDPAPGASSPTTSQSSVSEPTPTSKPKSS 106 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 28.7 bits (61), Expect = 4.1 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = +3 Query: 306 AVGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMER-RKRVEALMSSKLFRE 482 A G+ T S T + + EE+ ERLK+ + RE+++ RK VE E Sbjct: 1534 AAGVVVTRSVTATLASADVRREEQIERLKE---EFQEKSRELDKMRKEVE---GGGALVE 1587 Query: 483 ELERVLDQQCTRAATLPLLAEDQRR 557 L+ +L ++C L D+R+ Sbjct: 1588 TLQELLRERCEEVDVLKEKISDKRQ 1612 >SB_40461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -2 Query: 366 WTGARCRSGSSLSPSQPFRQLESIDLSSKTWVSNPVAQSFRSHARSSR 223 W CR GSS S +P E L + T ++P QS R A+ SR Sbjct: 276 WWADSCRGGSSASADEP----EPAGLVAVTLDASPAYQSLRHLAKLSR 319 >SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 759 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 333 LSPSQPFRQLESIDLSSKTWVSNPVAQSFRSHARSSRWPGVA 208 L P PF++LES+ + K VS V++ A S PG A Sbjct: 451 LEPMLPFKRLESLPIPDKVTVSMTVSEPAVLTALSDLHPGKA 492 >SB_52455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.7 bits (61), Expect = 4.1 Identities = 21/76 (27%), Positives = 32/76 (42%) Frame = +3 Query: 306 AVGMAETDSETIPNGTGPLSTEEEDERLKQRPADIDADVREMERRKRVEALMSSKLFREE 485 +V ++ ET + G +T ER +RP +D RE+ R A K RE+ Sbjct: 29 SVSSVRSERETPRDRNGRTATRRRPERRDERPRKLDDKPRELLDRDSGRAGSGEK--RED 86 Query: 486 LERVLDQQCTRAATLP 533 R L++ R P Sbjct: 87 KHRRLEKPAQRERNDP 102 >SB_45968| Best HMM Match : DUF1279 (HMM E-Value=1.2) Length = 180 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Frame = +3 Query: 312 GMAETDSETI--PNGTGPL---STEEEDERLKQRPADIDADVREMERRK 443 G+ TD ETI PN + + E +ERL +R +++ + RE+E +K Sbjct: 23 GVVTTDRETIDDPNTSESRRQEARERNEERLSERIEELERENRELENQK 71 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 28.3 bits (60), Expect = 5.4 Identities = 23/70 (32%), Positives = 33/70 (47%) Frame = +1 Query: 325 RTQRRSRTAPGPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLLCPRSCSARNWNGSST 504 R+ RRSR+ P+R S SS R S+ K + S S+ PRS +R+ Sbjct: 243 RSARRSRSPQKSRSPQRSRSPRSSKRYRSSRSHRKHRSHSRSR--SPRSKRSRSPRKRRR 300 Query: 505 SNAPGRRRFR 534 S + RR+R Sbjct: 301 SKSRSPRRYR 310 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 326 GLRDDPERHRAPVHRGGRRALEAASGRHRRRCPRNGTPEARRSS 457 G RD R +P H RR+ + R RR R+ +P RR S Sbjct: 205 GYRDQRRRSHSPAHH--RRSRSRSRSRSPRRRRRSRSPRRRRRS 246 >SB_45720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 28.3 bits (60), Expect = 5.4 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -3 Query: 614 QERKLGPXRLSGVQFSRRPSPLILCKKRKRRRPGALLVEDPFQFLAEQLRG 462 + R+ GP L RR P+ L +RRR G V P Q E+ RG Sbjct: 86 RRRREGPIHLDSTMRRRREGPIHLDSTMRRRREG---VHPPGQHHEEEERG 133 >SB_40412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 211 SDKLDDHYT--QNSHTNLNGDRNRH*ARNIIFVKTRTYCSLYNFYS 80 SD D + Q+ NLN R N+ F T T+C L+N +S Sbjct: 316 SDSFDPFHAVGQSEGVNLNKVREHQVKVNVWFCPTNTHCRLHNKHS 361 >SB_43438| Best HMM Match : DUF965 (HMM E-Value=0.71) Length = 130 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 413 RRCPRNGTPEARRSSYVLEAVPRGIGTG 496 RR PR+ T + RR Y + ++PR G Sbjct: 78 RRIPRDDTLKDRRKVYAVSSIPRSASAG 105 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 342 PNGTGPLSTEEEDERLKQRPADIDADVREMERRKR 446 PNG P+ + RL RPAD+ D E + R Sbjct: 296 PNGRPPVPRQGPGSRLPPRPADMKPDGEREESKPR 330 >SB_39621| Best HMM Match : Extensin_2 (HMM E-Value=0.078) Length = 539 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 567 PPTISFDPLQEAEASPPWCIAGRGPVPIPRGT 472 PP PL + + PP +GR P PIP GT Sbjct: 421 PPLEEKTPLDKRASLPPPA-SGRPPAPIPSGT 451 >SB_34319| Best HMM Match : C2 (HMM E-Value=0.003) Length = 557 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 288 SSKTWVSNPVAQSFRSHA 235 +S+ WVS +A FRSHA Sbjct: 124 TSRAWVSESIADDFRSHA 141 >SB_21467| Best HMM Match : Peptidase_A17 (HMM E-Value=1.1e-22) Length = 1043 Score = 27.9 bits (59), Expect = 7.1 Identities = 10/46 (21%), Positives = 28/46 (60%) Frame = +3 Query: 372 EEDERLKQRPADIDADVREMERRKRVEALMSSKLFREELERVLDQQ 509 ++ + +K++ ++ + RE+ER+ VE L ++E++ +L ++ Sbjct: 80 QKQQDIKRQRETLEREQRELERKGEVEKLEEELTAQKEIQSILQEE 125 >SB_58782| Best HMM Match : Hormone_5 (HMM E-Value=2.1) Length = 215 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +1 Query: 136 VLSACYDRRSNLCVNFVCSDHLICRYAG 219 V+ C+ LC+N C H+I ++G Sbjct: 85 VIVTCFQTPHRLCINGTCMGHMIPMFSG 112 >SB_51216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +3 Query: 318 AETDSETIPNGTGPLSTEEEDERLKQRPADID------ADVREMERRKRVEALMSS 467 AE D + +ST ER++QRPA +D A VR ++ RV L ++ Sbjct: 27 AELDDVAMDTEEPSVSTTRRPERIRQRPARLDPTVWCTALVRNIDNHLRVSVLTTT 82 >SB_52016| Best HMM Match : Cystatin (HMM E-Value=0.87) Length = 212 Score = 27.5 bits (58), Expect = 9.4 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 304 ELSEWLRRTQRRSRTAPGPCPPRRKTSA*SSVRPTSTPMSAKWNAGSASKLLCPRSCSAR 483 +LS + +R RRS P PPRR++S PT S K A + + +S AR Sbjct: 149 QLSNYQQRV-RRSSDREAPPPPRRRSSDRGMTTPTRRRSSEKGPASQKPQFVV-QSAVAR 206 Query: 484 N 486 + Sbjct: 207 D 207 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 10/41 (24%) Frame = +2 Query: 365 HRGGRRALEAASGRHRR----------RCPRNGTPEARRSS 457 H+GG RA + +HRR R PR GTP R + Sbjct: 873 HKGGNRATQEREKKHRRNQPDKRRTQMRIPRKGTPRKRNQT 913 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +3 Query: 372 EEDERLKQRPADIDADVREMERRKRVEALMSSKLFREELERVLDQQCTRAATLPLLAEDQ 551 EE+ R K+ + E RR+ + L REE R+ D++ R E++ Sbjct: 1114 EEERRRKEEEEQRRREEEERRRREEEDRLREEARRREEERRLEDERWERE------REEE 1167 Query: 552 RRW 560 RRW Sbjct: 1168 RRW 1170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,286,095 Number of Sequences: 59808 Number of extensions: 464392 Number of successful extensions: 2169 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2162 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -