BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1387 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0015 + 15431648-15431796,15431878-15432061,15435370-154354... 30 1.4 >06_03_0015 + 15431648-15431796,15431878-15432061,15435370-15435455, 15436863-15436957,15437614-15437689,15438073-15438185, 15439849-15439955,15440227-15440400,15440691-15440915 Length = 402 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +1 Query: 358 MQYFIRLRRRRVDDYMHIIDSWTDAEFKNRMRLSKKNSISSYWWN 492 M Y+I + +R + + D+WT++E + + L K+SIS+ W N Sbjct: 209 MPYYIHFQDQRPLVFAALFDTWTNSEDRMPVILGDKDSIST-WLN 252 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,256,543 Number of Sequences: 37544 Number of extensions: 206024 Number of successful extensions: 341 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -