BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1384 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding pr... 25 3.2 AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-b... 25 3.2 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 3.2 AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding pr... 25 3.2 >AY146745-1|AAO12105.1| 153|Anopheles gambiae odorant-binding protein AgamOBP3 protein. Length = 153 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +2 Query: 128 ETLANNRPKI*ACISNEGQTKDRFIHTAHGDSKMDSRDLCAMRCL 262 E L +P AC++ G ++D + + D + C M CL Sbjct: 42 ELLEKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCL 86 >AJ697725-1|CAG26918.1| 153|Anopheles gambiae putative odorant-binding protein OBPjj15 protein. Length = 153 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +2 Query: 128 ETLANNRPKI*ACISNEGQTKDRFIHTAHGDSKMDSRDLCAMRCL 262 E L +P AC++ G ++D + + D + C M CL Sbjct: 42 ELLEKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCL 86 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.6 bits (51), Expect = 3.2 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 354 NTLHTSSSDTYSLHSGTQFRKHC*SAVY*SPGHKRSR 464 NT +SSS S HSGT K + SPG K+ R Sbjct: 966 NTNSSSSSGKKSSHSGTNSSKRKKTV---SPGEKKDR 999 >AF437886-1|AAL84181.1| 153|Anopheles gambiae odorant binding protein protein. Length = 153 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +2 Query: 128 ETLANNRPKI*ACISNEGQTKDRFIHTAHGDSKMDSRDLCAMRCL 262 E L +P AC++ G ++D + + D + C M CL Sbjct: 42 ELLEKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCL 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,574 Number of Sequences: 2352 Number of extensions: 16652 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -