BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1379 (771 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 27 0.64 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 27 0.85 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 6.0 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 27.1 bits (57), Expect = 0.64 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 345 INFDSIDDINSGLLTSNVNF 404 +N D +IN GL+TSN++F Sbjct: 403 MNLDGYANINRGLITSNISF 422 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 26.6 bits (56), Expect = 0.85 Identities = 18/68 (26%), Positives = 25/68 (36%) Frame = +1 Query: 73 TTSRHNNDMTAWPAVALCLLVCTSQWASADVELITKPRPGEEYVIVSSGQQPAPVKASAK 252 T+ NN+ +P L L + A D+ L RPGE S +P + Sbjct: 1340 TSIHRNNNFQTFPQAVLVLFRSATGEAWQDIMLDCSSRPGEVNCDAKSDDAGSPEGCGSN 1399 Query: 253 QKTKYLIS 276 Y IS Sbjct: 1400 IAFPYFIS 1407 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 6.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 21 QPDRAGRRARTHHS*YPHDLTSQQRHDRVARRRPM 125 Q G HH + H SQQ+H R PM Sbjct: 174 QQQHPGHSQHHHHHHHHHPHHSQQQHSASPRCYPM 208 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,448 Number of Sequences: 2352 Number of extensions: 13803 Number of successful extensions: 58 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -