BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1377 (531 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25400.1 68418.m03013 phosphate translocator-related low siim... 28 4.5 At5g11230.1 68418.m01312 phosphate translocator-related low simi... 28 4.5 >At5g25400.1 68418.m03013 phosphate translocator-related low siimilarity to phosphoenolpyruvate/phosphate translocator precursor [Mesembryanthemum crystallinum] GI:9295275, SP|P52178 Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT) {Brassica oleracea} Length = 349 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 206 FCIHVYDNKILLFKLYQFNFFVFMSMIIKSFC 301 F + VY+ IL K+Y + F + ++MI SFC Sbjct: 30 FTVIVYNKYILDKKMYDWPFPISLTMIHMSFC 61 >At5g11230.1 68418.m01312 phosphate translocator-related low similarity to phosphoenolpyruvate/phosphate translocator precursor [Mesembryanthemum crystallinum] GI:9295275, SP|P52178 Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT) {Brassica oleracea} Length = 351 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 206 FCIHVYDNKILLFKLYQFNFFVFMSMIIKSFC 301 F + VY+ IL K+Y + F + ++MI SFC Sbjct: 30 FTVIVYNKYILDKKMYNWPFPISLTMIHMSFC 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,554,211 Number of Sequences: 28952 Number of extensions: 157968 Number of successful extensions: 311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -