BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1375 (760 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.0 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 6.1 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 36 YILFYNKYLFKLCFFITQTFYFY 104 ++LFY ++ F+ T+YFY Sbjct: 82 HLLFYCPFIIFTVHFLLCTYYFY 104 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/44 (22%), Positives = 19/44 (43%) Frame = +2 Query: 92 ILFLQTCLINISVHIGAYTQFILLQKKSSWSFTIHFYIIINSTN 223 +LF+Q + + T I +KK W+ I +++ N Sbjct: 346 VLFIQVAADTVLFILNISTIIITARKKQQWNSLIKILKTVSNRN 389 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +2 Query: 95 LFLQTCLINISVHIGAYTQFILLQKKSSWSFTIHFYIIINST 220 L +QTCL + + + T ++K+ W+ I ++ +T Sbjct: 64 LIVQTCLDFLLLALNISTILTTVRKQQQWAQLIQNLKVVATT 105 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,173 Number of Sequences: 336 Number of extensions: 3897 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -