BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1375 (760 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 5.9 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 7.7 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.8 bits (49), Expect = 5.9 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 595 RIVSTGVYPVNPKKQ--VSTIVKPFRFXG 675 R + TGV+P N KKQ V +I KP + G Sbjct: 446 RCLDTGVFPDNWKKQRLVLSIPKPGKRPG 474 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 321 LA*FMYRNHSLYTLQVIRIAVILIFGTYIHSMMLVLF 211 +A + N +LYT+ ++FG H M++ LF Sbjct: 386 IASYREANPALYTIITFPFLFGIMFGDLGHGMIMALF 422 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,952 Number of Sequences: 2352 Number of extensions: 14352 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -