BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1374 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0974 - 9813896-9813950,9814537-9814572,9814666-9814708,981... 28 6.4 06_01_0084 + 675185-677389 27 8.5 >08_01_0974 - 9813896-9813950,9814537-9814572,9814666-9814708, 9814881-9815277 Length = 176 Score = 27.9 bits (59), Expect = 6.4 Identities = 20/75 (26%), Positives = 29/75 (38%) Frame = -2 Query: 367 FSLINYALTPSALTLGAGLGTSVTVLVELDKEFAVQPNHESAR*VSRRIFSAGCVCGLIR 188 FS Y PS LT+ T +E+ + P+ + + S + CGL Sbjct: 6 FSCCTYPPAPSPLTINESRRRLTTPDLEIPR---ASPSLDQPKPCSDEVMDRTGPCGLHL 62 Query: 187 SSRPSRRWTVTGNIP 143 PSRR + N P Sbjct: 63 GVMPSRRMPIDANPP 77 >06_01_0084 + 675185-677389 Length = 734 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -2 Query: 271 FAVQPNHESAR*VSRRIFSAGCVCGLIRSSRPSRRWTVTGNIPTYSPNI 125 FA++ E V+ I A C CG IR++R W T N +++ I Sbjct: 186 FAIRSGLEELVNVATAILDAYCKCGDIRAARVVFDWMPTKNSVSWNAMI 234 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,100,895 Number of Sequences: 37544 Number of extensions: 229781 Number of successful extensions: 594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -