BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1372 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 1.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.0 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 497 FSRYYNQTSKSSHELLKIKYRHSNNRLTKKLLYL 598 F R+YN +KS+H I Y+ + + T ++ L Sbjct: 470 FWRFYNSKTKSTHTPKSITYKGATSANTNEMCNL 503 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 545 KIKYRHSNNRLTKKLLY 595 K+ Y H+NN L+ K +Y Sbjct: 1264 KVHYNHANNTLSTKSVY 1280 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 545 KIKYRHSNNRLTKKLLY 595 K+ Y H+NN L+ K +Y Sbjct: 1265 KVHYNHANNTLSTKSVY 1281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,154 Number of Sequences: 2352 Number of extensions: 9602 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -