BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1372 (676 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070493-1|AAL47964.1| 117|Drosophila melanogaster GH01976p pro... 31 1.4 >AY070493-1|AAL47964.1| 117|Drosophila melanogaster GH01976p protein. Length = 117 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +2 Query: 455 FVIXIL-FKXMTILKFSRYYNQTSKSSHELLKIKYRHSNNRLTKKLLYLNSV 607 FV+ L K +T L S YYN+ SK S +L+ K + N+L +LYL+ + Sbjct: 57 FVLRFLSIKNITNLFQSPYYNEHSKLSQLMLRGKRKSIKNQLQIIVLYLDKL 108 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,142,101 Number of Sequences: 53049 Number of extensions: 381153 Number of successful extensions: 610 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2930645700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -