BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1366 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0051 + 8576660-8576726,8579724-8579888,8579984-8581128 30 2.1 05_03_0637 - 16465433-16466242 29 4.8 03_05_0451 - 24456923-24457069,24457161-24457310,24457408-244575... 28 6.3 >10_05_0051 + 8576660-8576726,8579724-8579888,8579984-8581128 Length = 458 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 642 VDEVFHKLFRLNRHSATYPLRAMILDATTSLPSI-TAGC 529 +D VFHK RL + S Y ++L+ T P+I A C Sbjct: 301 IDPVFHKTGRLTQKSDVYSFGVVLLELITRKPTIYDANC 339 >05_03_0637 - 16465433-16466242 Length = 269 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 338 PVRPTFKQRHQPPGLHSTKHGLAGHHYSLQNVTEPNPRNPPM 213 P+RP + PP LH H HH+ LQ +P P PP+ Sbjct: 137 PLRPLLPR---PPHLHPAFHHQPFHHHLLQ--PQPPPPPPPL 173 >03_05_0451 - 24456923-24457069,24457161-24457310,24457408-24457513, 24457715-24458040,24458129-24458263,24458350-24458430, 24458516-24458704,24458794-24458986,24459068-24459174, 24459280-24459354,24459446-24459601,24459745-24459828, 24459933-24460046,24460119-24460214,24460302-24460392, 24460500-24460615,24460878-24461037,24461964-24462217 Length = 859 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/47 (27%), Positives = 20/47 (42%) Frame = -3 Query: 538 CGLRLAPAHAVPKGTEAGMPFQLFVMLSNYDLDRIDQDDGKQLTCVE 398 C L+ AP M + L + L++I DDG++ C E Sbjct: 758 CSLKAAPVFTFANQAGLDMLETTLIALQDISLEKILDDDGRKALCTE 804 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,045,826 Number of Sequences: 37544 Number of extensions: 446065 Number of successful extensions: 1104 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1103 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -