BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1365 (791 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) 35 0.087 SB_26689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_37671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_20579| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.39) 28 10.0 >SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) Length = 1128 Score = 34.7 bits (76), Expect = 0.087 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 249 QSDIQRVFVFIALLCIPVMLLGKPLYL 169 Q+ IQ + V IA+LC+P MLL KP YL Sbjct: 653 QAVIQPLLVVIAVLCVPWMLLVKPFYL 679 >SB_26689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/46 (26%), Positives = 29/46 (63%) Frame = -3 Query: 231 VFVFIALLCIPVMLLGKPLYLLATKKNNPKVQVQLTIPVTTGVGPI 94 VF F+ ++ +P++L+ L + +++P++++++ I V VG I Sbjct: 1016 VFFFVFVVMVPILLMN--LLPNSMLRDSPRIRIRVVIKVGLAVGDI 1059 >SB_37671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.9 bits (59), Expect = 10.0 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 187 EQHDG-DAEQRDEHEHA--LDVALSVNMNSLQPSSGTFFENSIMLMNRISTDGAQPWVYA 357 +Q DG D E+ D+ EH LD+ ++ ++ + + +RI Q W A Sbjct: 448 DQSDGGDNEEHDQTEHDAFLDLESGIHATGIRSPHRRIRNPRLKVESRIQESWKQKWNPA 507 Query: 358 SSGK 369 S+GK Sbjct: 508 STGK 511 >SB_20579| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.39) Length = 721 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 682 NFKFSVFNHKRPPQRFSSLTAPQ 614 N K +F+ RPP R SS APQ Sbjct: 521 NLKNELFSRSRPPSRASSPAAPQ 543 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,778,721 Number of Sequences: 59808 Number of extensions: 408395 Number of successful extensions: 830 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -