BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1364 (735 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_10252| Best HMM Match : tRNA-synt_2b (HMM E-Value=3.2e-32) 28 9.0 >SB_4340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 31.1 bits (67), Expect = 0.97 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 668 YIYWVLGDRFRKRKFCTYKVVNFGEGGISVAPGRSLTRASAV 543 +IY L +FR+ CT++ F G VA R L ++AV Sbjct: 284 FIYGALNPKFRRAFACTFRCRGFDGSGNRVAESRDLQLSTAV 325 >SB_10252| Best HMM Match : tRNA-synt_2b (HMM E-Value=3.2e-32) Length = 734 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 556 EHQLFLIYCFIAGFCFFLSEIMFFYETIFSFICTNM 449 + +LF + G CFFL + Y T+ +FI +M Sbjct: 372 DQELFFFHELSPGSCFFLPKGAVIYNTLINFIKEHM 407 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,653,578 Number of Sequences: 59808 Number of extensions: 269455 Number of successful extensions: 354 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -