BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1364 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.0 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.0 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.0 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.0 U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 22 6.9 AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 6.9 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 490 FFYETIFSFICTNMMERK 437 F Y ++ F+C N + RK Sbjct: 373 FIYASLLEFVCVNYVGRK 390 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 490 FFYETIFSFICTNMMERK 437 F Y ++ F+C N + RK Sbjct: 342 FIYASLLEFVCVNYVGRK 359 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 490 FFYETIFSFICTNMMERK 437 F Y ++ F+C N + RK Sbjct: 393 FIYASLLEFVCVNYVGRK 410 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 3.0 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 490 FFYETIFSFICTNMMERK 437 F Y ++ F+C N + RK Sbjct: 342 FIYASLLEFVCVNYVGRK 359 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 21.8 bits (44), Expect = 6.9 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 600 KIYNFVGTKFSFSEAVS*HPVYIYTEELNHYLHRGARVTRH 722 KIY VG F A+ PV E L H+ R RH Sbjct: 2 KIYFIVGLLFMAMVAIMAAPVEDEFEPLEHF-ENEERADRH 41 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 21.8 bits (44), Expect = 6.9 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 600 KIYNFVGTKFSFSEAVS*HPVYIYTEELNHYLHRGARVTRH 722 KIY VG F A+ PV E L H+ R RH Sbjct: 2 KIYFIVGLLFMAMVAIMAAPVEDEFEPLEHF-ENEERADRH 41 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,558 Number of Sequences: 438 Number of extensions: 3060 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -