BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1360 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 3.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 9.5 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 9.5 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 9.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.5 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 623 KSKQSCPSHRNVCPIRESNAR 685 K +Q C ++N CP++ N R Sbjct: 483 KQRQQC--NQNKCPVKRGNGR 501 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 561 MYFSFCHVPNTGNH 520 +Y F H P GNH Sbjct: 692 IYRPFSHFPRCGNH 705 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -3 Query: 203 QLSIAVYMSILFYVLL*TLLVILKQINKYIGF 108 Q+ + +++ F+V++ LLV + + K + F Sbjct: 154 QMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRF 185 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -3 Query: 203 QLSIAVYMSILFYVLL*TLLVILKQINKYIGF 108 Q+ + +++ F+V++ LLV + + K + F Sbjct: 154 QMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRF 185 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 52 WKQLKKTYVSRDTLIIEPGNPMYL 123 WK + +V + P NP+Y+ Sbjct: 88 WKYVNGEWVPGGKAEVPPSNPIYI 111 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,273 Number of Sequences: 336 Number of extensions: 2393 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -