BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1358 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contai... 29 2.2 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 29 3.8 At2g01930.2 68415.m00128 expressed protein 27 8.8 At2g01930.1 68415.m00127 expressed protein 27 8.8 >At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contains Pfam domains PF00628: PHD-finger and PF00855: PWWP domain; identical to cDNA trithorax 3 (ATX3) partial cds GI:15217142 Length = 799 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -3 Query: 350 DSILDSSA*NFSCLNLRRDNVYAISSTLKSPGHSSINAKTKASNTFEAFSIFYDFLRRTC 171 DS+ + +S N ++ ++ AIS LK P H S++A ++ +FS F+ C Sbjct: 697 DSLSAARCRIYSRSNTKKIDLEAISHRLKGPSHHSLSAIENLNSFKASFSFRAPFMSVFC 756 Query: 170 VL 165 L Sbjct: 757 FL 758 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 152 QKTTKEHKFVVENHKKSRKLQTCLKLSFLH*WNYDLDSLTLSLSHI 289 QKT H VV K + LSFLH W D + + ++H+ Sbjct: 817 QKTLDNHAEVVHMDKAIGEYLIRFSLSFLHLWGIDFELDQMLVAHL 862 >At2g01930.2 68415.m00128 expressed protein Length = 283 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = -3 Query: 323 NFSCLNLRRDNVYAISSTLKSPGHSSINAKTKASNTFE 210 N+S +N +DN + + +P +S++ ++T SN+ + Sbjct: 63 NYSWINQPKDNKFFNMLPISTPSYSNVLSETSGSNSIQ 100 >At2g01930.1 68415.m00127 expressed protein Length = 283 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/38 (26%), Positives = 23/38 (60%) Frame = -3 Query: 323 NFSCLNLRRDNVYAISSTLKSPGHSSINAKTKASNTFE 210 N+S +N +DN + + +P +S++ ++T SN+ + Sbjct: 63 NYSWINQPKDNKFFNMLPISTPSYSNVLSETSGSNSIQ 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,265,597 Number of Sequences: 28952 Number of extensions: 249615 Number of successful extensions: 585 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -