BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1357 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0180 - 13879648-13880064 28 8.0 01_06_0430 + 29299970-29300031,29300162-29300294,29301057-293011... 28 8.0 >10_07_0180 - 13879648-13880064 Length = 138 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 300 ARRKRSCTEDERRIPHFSDRGDSGNFGEWGGVRYG 196 ARR+R RR G +G WGGVR+G Sbjct: 64 ARRQRRLDWGGRRCGGCRRAGATGRLRRWGGVRHG 98 >01_06_0430 + 29299970-29300031,29300162-29300294,29301057-29301160, 29302201-29302372,29302488-29302628,29302707-29303055, 29303133-29305477 Length = 1101 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 282 SFAYDVQDSLTG--DSKTQHETRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNA 443 S +D Q+ G S + D DV G +++DP +K T + T + H GF++ Sbjct: 558 STIWDSQNDKAGPDSSAVVFDQYDSDV--GEENLLDPFSSKHTEEPTVEDHKGFSS 611 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,106,954 Number of Sequences: 37544 Number of extensions: 227837 Number of successful extensions: 718 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -