BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1353 (713 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 24 1.1 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 24 1.1 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 24 1.4 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 23 1.9 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 7.5 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 473 IFGYMYVTCTR-RLKSIGAEVIIELTFQVLVIALL 372 IFG++ TCTR +S ++ + QVL ++ + Sbjct: 23 IFGFVTFTCTRSNFRSSKLLILYNIILQVLFVSFV 57 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 473 IFGYMYVTCTR-RLKSIGAEVIIELTFQVLVIALL 372 IFG++ TCTR +S ++ + QVL ++ + Sbjct: 41 IFGFVTFTCTRSNFRSSKLLILYNIILQVLFVSFV 75 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 504 N*PIDIDNIDLYQLITSCNK 563 N ++IDNIDLY+ I + N+ Sbjct: 199 NGAVNIDNIDLYEEIFNGNR 218 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 504 N*PIDIDNIDLYQLITSCNK 563 N +++DNIDLY+ I + N+ Sbjct: 192 NGAVNVDNIDLYEEIFNGNR 211 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +3 Query: 243 NIWAQFTINGIGWDTFLQAFC 305 N WA T + W+ F+ C Sbjct: 523 NPWANCTASTRCWEVFMDGIC 543 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,755 Number of Sequences: 336 Number of extensions: 3357 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -