BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1353 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55418| Best HMM Match : GWT1 (HMM E-Value=1.5) 35 0.057 SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) 29 2.8 SB_46499| Best HMM Match : F-box (HMM E-Value=1.2e-11) 29 3.7 SB_7453| Best HMM Match : Microcin (HMM E-Value=2) 29 4.9 SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_55418| Best HMM Match : GWT1 (HMM E-Value=1.5) Length = 260 Score = 35.1 bits (77), Expect = 0.057 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 275 WMGYVFASFLWCSALFMFLMQMSKLSF 355 W YV+ +LW S+ FMF+M++S LS+ Sbjct: 117 WNEYVYRDYLWQSSRFMFIMRLSILSY 143 >SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) Length = 1725 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 320 RVLNT-TKSLQKRIPSNSIYGELSPNISKYFILNQYSTKT 204 R+L T T SL I + YG++SP++ F N Y T Sbjct: 1031 RLLFTDTDSLMYEIETRDFYGDISPDVKSMFDTNNYPKAT 1070 >SB_46499| Best HMM Match : F-box (HMM E-Value=1.2e-11) Length = 335 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -1 Query: 464 YMYVTCTRRLKSIGAEVIIELTFQVLVIALLPTR*LQMT-ILTSA 333 Y+Y+TC RR+ G E ++ ++ ++L R L T I+T A Sbjct: 254 YLYLTCCRRITDTGVEALVHSMAELQGLSLAKCRELTSTGIVTIA 298 >SB_7453| Best HMM Match : Microcin (HMM E-Value=2) Length = 158 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 320 RVLNT-TKSLQKRIPSNSIYGELSPNISKYFILNQY 216 R+L T T SL I + YG++SP++ F N Y Sbjct: 43 RLLFTDTDSLMYEIETRDFYGDISPDVKSMFDTNNY 78 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 573 RKIIICVITGGRTSCESALVGTSTLPIAA*NNNASRLXGGGTVLT 707 R ++ + TGG T+ + GT+T P++ S + GT T Sbjct: 1532 RTTVVPISTGGTTTAPRSTDGTATAPMSTEGTRTSPMSTDGTTAT 1576 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,145,688 Number of Sequences: 59808 Number of extensions: 350126 Number of successful extensions: 770 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -