BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1352 (204 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 0.36 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 0.36 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 0.36 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 0.36 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 20 3.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 20 3.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 20 3.4 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 19 4.5 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 19 4.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 19 4.5 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 19 5.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 19 5.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 19 5.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 19 5.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 19 7.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 19 7.8 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 19 7.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 19 7.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 19 7.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 19 7.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 19 7.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 19 7.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 19 7.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 19 7.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 19 7.8 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 0.36 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 101 SWSRRAFSKGRRGVTYVFENTDGTL 27 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 0.36 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 101 SWSRRAFSKGRRGVTYVFENTDGTL 27 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 0.36 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 101 SWSRRAFSKGRRGVTYVFENTDGTL 27 S++ + S + +TYV++N +GTL Sbjct: 252 SFAIESISYEQTAITYVWKNDEGTL 276 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 0.36 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 101 SWSRRAFSKGRRGVTYVFENTDGTL 27 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 19.8 bits (39), Expect = 3.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 4 ELAKMVNNRVPSVFSKT 54 EL V+ +P+VF+KT Sbjct: 311 ELLTPVSTMLPAVFAKT 327 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 19.8 bits (39), Expect = 3.4 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -2 Query: 125 PYSPMIFNSW 96 PY +++NSW Sbjct: 467 PYDHLVWNSW 476 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 19.8 bits (39), Expect = 3.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 4 ELAKMVNNRVPSVFSKT 54 EL V+ +P+VF+KT Sbjct: 311 ELLTPVSTMLPAVFAKT 327 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 19.4 bits (38), Expect = 4.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 55 YVTPRRPFEKARLDQELKIIGEYGLR 132 Y+ +RP + RL + GEY R Sbjct: 89 YLKTKRPKDWERLSAKYDSTGEYKKR 114 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 19.4 bits (38), Expect = 4.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 55 YVTPRRPFEKARLDQELKIIGEYGLR 132 Y+ +RP + RL + GEY R Sbjct: 89 YLKTKRPKDWERLSAKYDSTGEYKKR 114 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 19.4 bits (38), Expect = 4.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 21 EQQSTVGIFKDVRDTSSSF*KGTS*PRVEDHRRV 122 ++ T G KDV T G+ P +++H V Sbjct: 485 QETRTPGFGKDVLATDERSFSGSRNPLLQEHDSV 518 Score = 18.6 bits (36), Expect = 7.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 97 GQDVPFQKDDEVSRTS 50 G K +EVSRTS Sbjct: 709 GDSFKVSKHEEVSRTS 724 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 19.0 bits (37), Expect = 5.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 101 SWSRRAFSKGRRGVTYVFENTDGTL 27 SW R + G GV + N D ++ Sbjct: 2 SWQRVFLAVGLFGVLLLLTNADNSV 26 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 19.0 bits (37), Expect = 5.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 Query: 81 FKRTTRCHVR 52 F+RT+ CH R Sbjct: 224 FQRTSSCHSR 233 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 18.6 bits (36), Expect = 7.8 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +1 Query: 118 EYGLRNKREVWRVK 159 E L+++REVW ++ Sbjct: 33 EERLQHRREVWLIQ 46 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 18.6 bits (36), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 131 RRPYSPMIFNSWSRR 87 +RP +F SWS R Sbjct: 663 KRPDLLHLFGSWSNR 677 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 18.6 bits (36), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 131 RRPYSPMIFNSWSRR 87 +RP +F SWS R Sbjct: 663 KRPDLLHLFGSWSNR 677 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 18.6 bits (36), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 131 RRPYSPMIFNSWSRR 87 +RP +F SWS R Sbjct: 663 KRPDLLHLFGSWSNR 677 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,255 Number of Sequences: 438 Number of extensions: 852 Number of successful extensions: 50 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 146,343 effective HSP length: 45 effective length of database: 126,633 effective search space used: 2785926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -