BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1350 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 3.2 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 4.2 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 7.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.8 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 108 LAYSQYRQTFTSMKENIEEYI 170 LAY + RQ F + K+NI E+I Sbjct: 284 LAY-KIRQVFPNEKKNISEFI 303 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 Query: 496 SV*RHTGSFLGKEGKDFEFSHIRNKVEFA 582 S+ HT S + +G DF + + + V +A Sbjct: 297 SIDNHTLSVISTDGSDFNATEVDSLVTYA 325 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 631 PLQEWISEALDWNYHYY 681 PL A+D+NY+YY Sbjct: 51 PLALSNKNAIDFNYYYY 67 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +2 Query: 383 CNKQDQPLAKGSQVIKGLLEKEINLVRVTKSNQLQSVDPSEGTPGR 520 C K + S+ ++GLLE +++ Q + + + PGR Sbjct: 734 CPKNRPTFTELSKSLEGLLENVAQYLQIENVEQTLNHEIKKVIPGR 779 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,856 Number of Sequences: 336 Number of extensions: 3482 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -