BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1345 (811 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29556| Best HMM Match : Ion_trans (HMM E-Value=0) 33 0.21 SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) 33 0.27 SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_1368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_29556| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 712 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = -1 Query: 250 IVKVIQYLVKNGTPLYQSRNSDIFQDFLIISLAQTDLLLHSTMS*ISVFRYFRLFSYF 77 ++++I ++ G Y S+ +IF F+++ L+ T+LLL + + +SVFR RL F Sbjct: 241 VLEMIINVISFGIMGYLSQLQNIFDGFVVV-LSVTELLLENGYARLSVFRSIRLLRIF 297 >SB_10083| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1457 Score = 33.1 bits (72), Expect = 0.27 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = -1 Query: 250 IVKVIQYLVKNGTPLYQSRNSDIFQDFLIISLAQTDLLLHSTMS*ISVFRYFRLFSYF 77 ++++I ++ G Y S+ +IF F ++ L+ T+LLL + + +SVFR RL F Sbjct: 498 VLEMIINVISFGIMGYLSQLQNIFDGF-VVGLSVTELLLENGYARLSVFRSIRLLRIF 554 >SB_13906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = -3 Query: 566 TESTIGSINTGNLTSNPMINSTPN*TKACRNSQLASLQTCRSQVFESSCTKSNSLS 399 T ST ++ TS+P++ +T + + S +A+ T + ESS T +N+ S Sbjct: 505 TNSTTSTLAEAVATSSPVLPTTTSVLTSSMESSMATTSTTSTPSLESSMTTNNTTS 560 >SB_1368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -1 Query: 475 IVSWLPCKHAGLKSLRVVVQKVTVYQEMKSCAWIYWIVKQSC 350 + WLPC HA LK V ++ Q M+ + +SC Sbjct: 29 LTDWLPCYHAELKGAEDVPNEIWHQQRMRDALILQDPEHESC 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,189,202 Number of Sequences: 59808 Number of extensions: 538342 Number of successful extensions: 1093 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -