BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1334 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 6.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 22 7.9 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 6.0 Identities = 14/61 (22%), Positives = 19/61 (31%) Frame = +1 Query: 46 HHWRLRHPVPCGGSSS*HVQDDLHRMEISERSQCACQSPGAQ*MMGCSQLACGHEYAFAG 225 HH H P GG SS +D S Q C ++ H+ G Sbjct: 161 HHHHHHHNAPAGGESSTSEKDSSRESSKSPMLMKMLTDKQEQTCQWCRKVIPSHQTGILG 220 Query: 226 S 228 + Sbjct: 221 T 221 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.2 bits (45), Expect = 7.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 321 LGLKIEDFLERRLQTQVF 268 LG KIE L+R +T+VF Sbjct: 2934 LGRKIETGLDRLAETEVF 2951 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 415,393 Number of Sequences: 2352 Number of extensions: 8448 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -