BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1332 (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 28 0.062 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 27 0.19 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 5.4 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 22 5.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 5.4 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.1 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 21 9.4 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 28.3 bits (60), Expect = 0.062 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = +1 Query: 478 LNISV*PSDQTWGSKAVMSLLLLPEVSKRVSTVVIH 585 +NI+ PS+Q WG ++ L++ P ++ ++TV ++ Sbjct: 368 INITTVPSEQQWG---ILVLIIAPLIATLIATVTVN 400 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 26.6 bits (56), Expect = 0.19 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = -1 Query: 462 KEREFEWLSETGSSLIEVAKKEEK---SYSKNTSKQLKDMEERWRKLQ 328 ++R E L+E SSLI++ + EEK SYS N + D + K++ Sbjct: 30 EKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHSPVFGKVE 77 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 113 LSTFGFNFFMCIVSFFEFLI 172 L T +FF+C++ F F++ Sbjct: 292 LGTVVLSFFLCLIPFRVFIL 311 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = -3 Query: 172 DEKFKERDDTHKEIEAESGEVCETLNLCDLVFNDPDVL 59 D +F + + SGE LC F+D L Sbjct: 56 DRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTL 93 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 379 KHVKTVEGHGRK 344 KHVKT G+G+K Sbjct: 392 KHVKTHNGNGKK 403 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = -3 Query: 172 DEKFKERDDTHKEIEAESGEVCETLNLCDLVFNDPDVL 59 D +F + + SGE LC F+D L Sbjct: 312 DRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTL 349 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 441 LSETGSSLIEVAKKEEKSYSKNTSKQLKDMEERWRKLQ 328 L+ T +L KKEE S + KQ ++ ++ +KLQ Sbjct: 1357 LASTELNLCCTKKKEELSPNALLDKQAVEIVKQLQKLQ 1394 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 441 LSETGSSLIEVAKKEEKSYSKNTSKQLKDMEERWRKLQ 328 L+ T +L KKEE S + KQ ++ ++ +KLQ Sbjct: 1357 LASTELNLCCTKKKEELSPNALLDKQAVEIVKQLQKLQ 1394 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 441 LSETGSSLIEVAKKEEKSYSKNTSKQLKDMEERWRKLQ 328 L+ T +L KKEE S + KQ ++ ++ +KLQ Sbjct: 1357 LASTELNLCCTKKKEELSPNALLDKQAVEIVKQLQKLQ 1394 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 441 LSETGSSLIEVAKKEEKSYSKNTSKQLKDMEERWRKLQ 328 L+ T +L KKEE S + KQ ++ ++ +KLQ Sbjct: 1357 LASTELNLCCTKKKEELSPNALLDKQAVEIVKQLQKLQ 1394 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 582 PFRESFESRIKYGXKFSS 635 P R + SRI+Y + SS Sbjct: 39 PLRSFYRSRIRYQGRISS 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,657 Number of Sequences: 336 Number of extensions: 2711 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -