BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1332 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 27 0.42 Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase pr... 24 3.9 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 5.1 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 5.1 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 6.8 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 27.5 bits (58), Expect = 0.42 Identities = 18/66 (27%), Positives = 35/66 (53%) Frame = -1 Query: 504 IRRLNADVQAETAMKEREFEWLSETGSSLIEVAKKEEKSYSKNTSKQLKDMEERWRKLQE 325 +RR DVQA+ A ER SE + + + A++ E+ + L +E+R ++ E Sbjct: 387 VRRTLQDVQAKQAAIERGMRNASERVTRIQKDARQIEQDLQERNRDGLSQVEQR-KQAVE 445 Query: 324 TGRSRI 307 T ++++ Sbjct: 446 TEKAQL 451 >Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase protein. Length = 137 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 151 DDTHKEI-EAESGEVCETLNLCDLVFN 74 D KE+ ++ S EVC +N+CD FN Sbjct: 87 DWIEKEVNQSLSYEVCTGVNVCDRKFN 113 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 139 KEIEAESGEVCETLNLCDLVFN 74 + + A+S + E L LCD++FN Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFN 80 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.8 bits (49), Expect = 5.1 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = -1 Query: 504 IRRLNADVQAETAMKEREFEWLSETGSSLIEVAKKEEKSY-----SKNTSKQLKDMEERW 340 +RR + E +KE++ + L + + KEE+ K+ +KQ+KD Sbjct: 354 MRRKEEECSRELNLKEQKRKELYAKQGRGSQFSSKEERDKWIQGELKSLNKQIKDKISHQ 413 Query: 339 RKLQETGRSRIVK 301 KLQ+ + I K Sbjct: 414 NKLQDDLKKDIAK 426 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 378 NTSKQLKDMEERWRKLQETGRSRIVKI 298 N +L + ERW +QE R +I K+ Sbjct: 990 NLGMKLLESPERWNSIQEAAR-KITKV 1015 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,146 Number of Sequences: 2352 Number of extensions: 10937 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -