BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1332 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.51 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 24 1.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 6.3 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 25.4 bits (53), Expect = 0.51 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 141 IKKLKPKVERCVKL*ISAILCSTTPMFSKVTSISET*E 28 +KKL P+ E C +L ++ IL P F V + + E Sbjct: 262 LKKLCPQEEACFRLLMNDILRPYVPEFKGVLDVKDVEE 299 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 25.4 bits (53), Expect = 0.51 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 141 IKKLKPKVERCVKL*ISAILCSTTPMFSKVTSISET*E 28 +KKL P+ E C +L ++ IL P F V + + E Sbjct: 177 LKKLCPQEEACFRLLMNDILRPYVPEFKGVLDVKDVEE 214 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.4 bits (53), Expect = 0.51 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 141 IKKLKPKVERCVKL*ISAILCSTTPMFSKVTSISET*E 28 +KKL P+ E C +L ++ IL P F V + + E Sbjct: 496 LKKLCPQEEACFRLLMNDILRPYVPEFKGVLDVKDVEE 533 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +1 Query: 499 SDQTWGSKAVMSLLLLPEVSKRVSTVVIHSVNRLNRVSNM 618 +++T + M ++ LP+ +K ++ VNR+NR+ M Sbjct: 348 NEETLQTVVAMKMMHLPQSNKMNRMHRMNRVNRVNRMDRM 387 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.8 bits (44), Expect = 6.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 421 SYRGSKERGKVI*QKHVKTVEGHGRKMAKTPGNW*I*NCENY*ITRNYN 275 SYR +E K + + RK+ + N I N NY NYN Sbjct: 293 SYRKYRETSKERSRDKTERERSKERKIISSLSNNYISNISNYNNNNNYN 341 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,704 Number of Sequences: 438 Number of extensions: 3421 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -