BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1330 (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1265 + 28847782-28849803 28 5.6 12_01_0359 + 2736797-2737050,2737801-2738153,2738583-2738821,273... 28 7.4 >06_03_1265 + 28847782-28849803 Length = 673 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +2 Query: 404 KLCDYIFEKATDQATQCKLRAMDTNNIKMLFKSG-PIVDSEKMAMNLINLLEI 559 KLC +FE+ + A+ C I K G I D+ K + L+ LL++ Sbjct: 298 KLCVAVFERRPEAASSCFAEIASRAGILDFLKFGRAICDARKDPIKLLRLLDV 350 >12_01_0359 + 2736797-2737050,2737801-2738153,2738583-2738821, 2738916-2739035,2739115-2739162 Length = 337 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 174 ESIQIIRNIKKNLESHFDYPRNVGELFKICR*DVR 278 + +++ NI+ NLE+ F+ P NV + + + + R Sbjct: 224 QMVEVNTNIQSNLETEFEIPENVSQAIGLKKKETR 258 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,581,026 Number of Sequences: 37544 Number of extensions: 259277 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -