BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1330 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.8 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 21 7.8 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 608 ISGIAELFLIEPSFQMLFPKG*LSS*PFFHCLLLV 504 +SG FL+ PS + P + S FF L+L+ Sbjct: 353 VSGPGLAFLVYPSAVLELPGSSIWSCLFFFMLILI 387 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +3 Query: 33 KSQLSQVSYVSPNKRARKENKDNYLYICLRD 125 K+ ++Q+ V+P+KR + +IC R+ Sbjct: 144 KNLINQMLTVNPSKRITASEALKHPWICQRE 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,616 Number of Sequences: 438 Number of extensions: 3658 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -