BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1328 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 6.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 355 LKSHIRFSTTVNINGISLYVVLTILYVDIY 266 LK TT+NI+ I+LY T DIY Sbjct: 777 LKFAFDVKTTLNISDIALYPSQTTHGYDIY 806 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 284 YSKYYIQRNTIDINRSRKP 340 Y +YY+ R+ +N +R+P Sbjct: 142 YDEYYVWRDARIVNGTRQP 160 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 486 LCKQIFDDSEVKSAHLR 436 LC++ FD + +HLR Sbjct: 66 LCQKAFDQKNLYQSHLR 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,970 Number of Sequences: 438 Number of extensions: 3987 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -