BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1324 (702 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 1.8 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 23 3.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 9.7 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 513 LTPTWC*VVTGNHRHLQRKCHHYLRYEF*GLSIVTTS 403 L+P C +V N H+++ + L +++ G ++T++ Sbjct: 90 LSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTST 126 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 513 LTPTWC*VVTGNHRHLQRKCHHYLRYEF*GLSIVTTS 403 L+P C +V N H+++ + L +++ G ++T++ Sbjct: 90 LSPEDCELVLSNPTHMEKSAIYNLLHDWLGTGLLTST 126 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 283 GLIFIIRCYSSPWKSIVNIC*VRISLEKLVP 191 GL F I + WK+ VN C V K++P Sbjct: 77 GLAFDIERQTCDWKTKVNNCDVIEKPRKVLP 107 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 287 CGFDFYYTMLFFTVEV 240 C + FYY + FTV + Sbjct: 112 CVYYFYYAFIIFTVHL 127 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 287 CGFDFYYTMLFFTVEV 240 C + FYY + FTV + Sbjct: 237 CIYYFYYAFILFTVHL 252 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -1 Query: 468 LQRKCHHYLRYE 433 +QRKC+H L Y+ Sbjct: 471 IQRKCNHGLVYD 482 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,049 Number of Sequences: 336 Number of extensions: 3199 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -