BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1324 (702 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ177379-1|ABA60840.1| 531|Drosophila melanogaster Iris protein. 30 2.6 DQ177373-1|ABA60834.1| 528|Drosophila melanogaster Iris protein. 30 2.6 DQ177372-1|ABA60833.1| 528|Drosophila melanogaster Iris protein. 30 2.6 DQ177371-1|ABA60832.1| 531|Drosophila melanogaster Iris protein. 30 2.6 DQ177370-1|ABA60831.1| 528|Drosophila melanogaster Iris protein. 30 2.6 DQ177369-1|ABA60830.1| 528|Drosophila melanogaster Iris protein. 30 2.6 DQ177368-1|ABA60829.1| 531|Drosophila melanogaster Iris protein. 30 2.6 DQ177367-1|ABA60828.1| 528|Drosophila melanogaster Iris protein. 30 2.6 DQ177366-1|ABA60827.1| 531|Drosophila melanogaster Iris protein. 29 6.1 AY069209-1|AAL39354.1| 531|Drosophila melanogaster GH26159p pro... 29 6.1 AE014134-205|AAF51415.1| 531|Drosophila melanogaster CG4715-PA ... 29 6.1 DQ177377-1|ABA60838.1| 528|Drosophila melanogaster Iris protein. 29 8.1 DQ177376-1|ABA60837.1| 528|Drosophila melanogaster Iris protein. 29 8.1 BT030136-1|ABN49275.1| 1239|Drosophila melanogaster IP16981p pro... 29 8.1 AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-P... 29 8.1 >DQ177379-1|ABA60840.1| 531|Drosophila melanogaster Iris protein. Length = 531 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177373-1|ABA60834.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177372-1|ABA60833.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177371-1|ABA60832.1| 531|Drosophila melanogaster Iris protein. Length = 531 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177370-1|ABA60831.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177369-1|ABA60830.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177368-1|ABA60829.1| 531|Drosophila melanogaster Iris protein. Length = 531 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177367-1|ABA60828.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ SL Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRSL 93 >DQ177366-1|ABA60827.1| 531|Drosophila melanogaster Iris protein. Length = 531 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ +L Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRNL 93 >AY069209-1|AAL39354.1| 531|Drosophila melanogaster GH26159p protein. Length = 531 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ +L Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRNL 93 >AE014134-205|AAF51415.1| 531|Drosophila melanogaster CG4715-PA protein. Length = 531 Score = 29.1 bits (62), Expect = 6.1 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ +L Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRNL 93 >DQ177377-1|ABA60838.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ L Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRDL 93 >DQ177376-1|ABA60837.1| 528|Drosophila melanogaster Iris protein. Length = 528 Score = 28.7 bits (61), Expect = 8.1 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = -3 Query: 304 CANYNFAGLIFIIRCYSSPWKSIVNIC*VRISL 206 CA++N L IR ++ +K++V++C ++ L Sbjct: 61 CASFNLESLYTAIRAFNGVYKALVDVCDIQRGL 93 >BT030136-1|ABN49275.1| 1239|Drosophila melanogaster IP16981p protein. Length = 1239 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 621 LAIFSLRLNSL*KIIDALKVSPYRC 695 L +FS RL SL KII+ L+ +P C Sbjct: 673 LKLFSERLGSLGKIIEVLEATPQNC 697 >AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-PA protein. Length = 5303 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 621 LAIFSLRLNSL*KIIDALKVSPYRC 695 L +FS RL SL KII+ L+ +P C Sbjct: 2195 LKLFSERLGSLGKIIEVLEATPQNC 2219 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,231,558 Number of Sequences: 53049 Number of extensions: 576044 Number of successful extensions: 1268 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1268 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -