BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1324 (702 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78201-3|CAD36504.1| 1066|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z78199-3|CAB01577.2| 1066|Caenorhabditis elegans Hypothetical pr... 29 2.4 AF108229-1|AAF17300.1| 1066|Caenorhabditis elegans VAB-8L protein. 29 2.4 >Z78201-3|CAD36504.1| 1066|Caenorhabditis elegans Hypothetical protein K12F2.2a protein. Length = 1066 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -1 Query: 192 PPEIRIPVHRLTRMHRTSYPLGLRYSIFEKYFPIHPISSRCVH 64 P IR P+HR TR H L S+ K P H C+H Sbjct: 404 PTSIR-PLHRTTRNHSGVEALSKPLSVETKSSPTHNCHDGCIH 445 >Z78199-3|CAB01577.2| 1066|Caenorhabditis elegans Hypothetical protein K12F2.2a protein. Length = 1066 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -1 Query: 192 PPEIRIPVHRLTRMHRTSYPLGLRYSIFEKYFPIHPISSRCVH 64 P IR P+HR TR H L S+ K P H C+H Sbjct: 404 PTSIR-PLHRTTRNHSGVEALSKPLSVETKSSPTHNCHDGCIH 445 >AF108229-1|AAF17300.1| 1066|Caenorhabditis elegans VAB-8L protein. Length = 1066 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = -1 Query: 192 PPEIRIPVHRLTRMHRTSYPLGLRYSIFEKYFPIHPISSRCVH 64 P IR P+HR TR H L S+ K P H C+H Sbjct: 404 PTSIR-PLHRTTRNHSGVEALSKPLSVETKSSPTHNCHDGCIH 445 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,047,725 Number of Sequences: 27780 Number of extensions: 302533 Number of successful extensions: 583 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -