BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1324 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.53 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 24 1.6 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 25.4 bits (53), Expect = 0.53 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 125 LGIRYLKNIFLYTLSRLDVCMCVLTNRFVRRV 30 +G +L IFL + VC+ + T+R +RR+ Sbjct: 28 VGFLFLILIFLSVAGNILVCVAIYTDRGLRRI 59 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +2 Query: 257 ITSYNKNQTRKIIVCAITGGRTSCESARVKYLRPAYFCREAVGF 388 I Y Q ++C+I GG + + V P F + V F Sbjct: 67 INQYGGEQPTLRLLCSIAGGTSESQWEDVTGSTPLTFVNDTVSF 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,757 Number of Sequences: 438 Number of extensions: 4392 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -