BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1321 (291 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 23 0.66 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 2.0 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 21 3.5 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 20 4.7 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 20 6.2 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 23.0 bits (47), Expect = 0.66 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 212 VYRSRFDCFVKIYTSSDFSAWV 147 V S F+ FVK Y SDF +V Sbjct: 29 VEESGFENFVKTYLVSDFENYV 50 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 2.0 Identities = 13/49 (26%), Positives = 19/49 (38%) Frame = +3 Query: 87 PAASVSYSSISTPINGKTIINPSTEVRRRINFYKTVEPAPVHETFSDHN 233 P+A S +TP G+ + ST +R T E P + N Sbjct: 419 PSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVSTTEAPPAPAVSNPQN 467 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 20.6 bits (41), Expect = 3.5 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -1 Query: 267 LWSDESKHFQHYCGRK 220 +WS E+ +CG K Sbjct: 349 IWSIETDDMHEFCGEK 364 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 20.2 bits (40), Expect = 4.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +3 Query: 204 PVHETFSDHNNAGNAYFHRSTNKTLI 281 P+H+T HNN + RS + + + Sbjct: 45 PIHQTVIYHNNPRDPNRARSVSYSTV 70 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 19.8 bits (39), Expect = 6.2 Identities = 5/25 (20%), Positives = 14/25 (56%) Frame = -1 Query: 267 LWSDESKHFQHYCGRKTFRVQEPVR 193 +WS ++ F+ CG+ + + ++ Sbjct: 355 VWSLDTDDFRGICGKGPYPIMNAIK 379 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,672 Number of Sequences: 336 Number of extensions: 1371 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 48 effective length of database: 106,457 effective search space used: 5109936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -