BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1321 (291 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 23 3.1 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 22 4.1 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 22 4.1 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 22 4.1 DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. 22 5.4 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 21 7.1 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 21 7.1 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 21 7.1 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 21 7.1 AJ438610-8|CAD27480.1| 82|Anopheles gambiae hypothetical prote... 21 7.1 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 21 9.4 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 21 9.4 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 21 9.4 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 21 9.4 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 21 9.4 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 21 9.4 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 21 9.4 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 211 TKRFPTTIMLEMLTFIAPQTKP 276 TKR PT I ++L+ P +P Sbjct: 25 TKRIPTAIQTDILSVDEPAPEP 46 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 196 NRLLYTKRFPTTIM 237 NR LYT FPT ++ Sbjct: 513 NRTLYTAHFPTHLL 526 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 Query: 90 AASVSYSSISTPINGKTIINPSTEVRRRINFY 185 A SV+Y++ + N + +NP+T+ + +Y Sbjct: 471 AWSVNYNTSTVMTNKELQLNPTTDYSETVYWY 502 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 83 STCSISVIFFNIYANQWQN 139 ST S I FN+ +W+N Sbjct: 117 STAMFSKILFNLTGQRWRN 135 >DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. Length = 153 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 194 DCFVKIYTSSDFSAW 150 +C +IY S F+AW Sbjct: 119 ECAKQIYNDSGFAAW 133 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 212 VYRSRFDCFVKIYTSSDFSAWVDNSFA 132 +Y++ DC+VKI A+ +F+ Sbjct: 252 MYKNTLDCWVKIGKQEGSGAFFKGAFS 278 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 212 VYRSRFDCFVKIYTSSDFSAWVDNSFA 132 +Y++ DC+VKI A+ +F+ Sbjct: 252 MYKNTLDCWVKIGKQEGSGAFFKGAFS 278 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +3 Query: 51 VARASIIDTDYPP--AASVSYSS 113 VA+ + +D DYPP +V++SS Sbjct: 239 VAKFATLDLDYPPYGLPTVAWSS 261 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -2 Query: 212 VYRSRFDCFVKIYTSSDFSAWVDNSFA 132 +Y++ DC+VKI A+ +F+ Sbjct: 252 MYKNTLDCWVKIGKQEGSGAFFKGAFS 278 >AJ438610-8|CAD27480.1| 82|Anopheles gambiae hypothetical protein protein. Length = 82 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 142 LSTQALKSEDV*IFTKQSNRLLYTK 216 +S + LK E+ IFT + LLY + Sbjct: 1 MSRELLKREEGIIFTVSNTPLLYAR 25 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 63 SIIDTDYPPAASVSYSSISTPINGKTIINP 152 S I +YP +YS + +P T++ P Sbjct: 49 SKIREEYPDRIMNTYSVVPSPKVSDTVVEP 78 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 63 SIIDTDYPPAASVSYSSISTPINGKTIINP 152 S I +YP +YS + +P T++ P Sbjct: 49 SKIREEYPDRIMNTYSVVPSPKVSDTVVEP 78 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 63 SIIDTDYPPAASVSYSSISTPINGKTIINP 152 S I +YP +YS + +P T++ P Sbjct: 49 SKIREEYPDRIMNTYSVVPSPKVSDTVVEP 78 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 63 SIIDTDYPPAASVSYSSISTPINGKTIINP 152 S I +YP +YS + +P T++ P Sbjct: 49 SKIREEYPDRIMNTYSVVPSPKVSDTVVEP 78 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = +3 Query: 24 IITILCYLAV 53 IIT+LC+LA+ Sbjct: 9 IITVLCHLAI 18 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 170 TYKFLQNSRTGSCTRNVFR 226 TY+F N+ TG+ R R Sbjct: 487 TYRFAVNNTTGAARRGTCR 505 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = +3 Query: 24 IITILCYLAV 53 IIT+LC+LA+ Sbjct: 9 IITVLCHLAI 18 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 306,423 Number of Sequences: 2352 Number of extensions: 5478 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 17819379 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -