BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1318 (683 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 5.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.4 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 117 DKTDGTLHFIDTAV-LTTCHIIY 182 +K DGTL IDT + +T +++ Sbjct: 76 NKNDGTLTIIDTGIGMTKADLVH 98 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.4 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 569 LYYFYLQCFILNSITLFSIALLTLYERSLIYYIPYFLY 682 +YYFY FI+ +I L +L + +Y + L+ Sbjct: 212 IYYFY-SAFIIFTIHLLFYCVLIILLCIYYFYYAFILF 248 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/43 (16%), Positives = 18/43 (41%) Frame = +2 Query: 554 VTFIVLYYFYLQCFILNSITLFSIALLTLYERSLIYYIPYFLY 682 + + +YYFY + L + + Y L++ + ++ Sbjct: 233 IILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLLFCCAFIIF 275 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,251 Number of Sequences: 336 Number of extensions: 3222 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -